PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009630679.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 246aa    MW: 28379.6 Da    PI: 9.8279
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009630679.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.78.1e-1890144256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ ++tkeq + Lee F+++ ++   +++eLA+kl+L+ rqV vWFqNrRa+ k
  XP_009630679.1  90 RKKLRLTKEQSTLLEESFKRHITLAMGKKQELAAKLKLKPRQVEVWFQNRRARTK 144
                     678899***********************************************98 PP

2HD-ZIP_I/II113.11.8e-3690178189
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                     +kk+rl+keq++lLEesF+++ +L   +K+ela +L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l++en+rL+ke +eLr+
  XP_009630679.1  90 RKKLRLTKEQSTLLEESFKRHITLAMGKKQELAAKLKLKPRQVEVWFQNRRARTKLKQTEVDCEFLKKWCQSLNDENSRLKKELQELRS 178
                     69*************************************************************************************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.71E-1773147IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-1777145IPR009057Homeodomain-like
PROSITE profilePS5007116.82786146IPR001356Homeobox domain
SMARTSM003893.0E-1488150IPR001356Homeobox domain
CDDcd000861.11E-1190147No hitNo description
PfamPF000463.6E-1590144IPR001356Homeobox domain
PROSITE patternPS000270121144IPR017970Homeobox, conserved site
SMARTSM003403.3E-17146189IPR003106Leucine zipper, homeobox-associated
PfamPF021831.1E-9146178IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MGNDNEICDT RLTLGLATSD LLPKQNQLEE HKKIICLDLS IPLHSSDMEE KKTEGSTSKI  60
CKNGQRQAPK SISPRNYNNF NSESNKNGMR KKLRLTKEQS TLLEESFKRH ITLAMGKKQE  120
LAAKLKLKPR QVEVWFQNRR ARTKLKQTEV DCEFLKKWCQ SLNDENSRLK KELQELRSIK  180
IDQWASPFHL QLPKIRTIAL CPSCQKTENI KSEQKHCDLD CGNRKVANDA MSKEANSETI  240
LVNEKN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1138146RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755192e-40HG975519.1 Solanum lycopersicum chromosome ch07, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009630679.10.0PREDICTED: homeobox-leucine zipper protein HAT9-like
TrEMBLM1DZM32e-92M1DZM3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000969705e-92(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29024186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.18e-43HD-ZIP family protein